RPL36AL Rabbit Polyclonal Antibody TA334365 from OriGene Technologies | Biocompare.com

Supplier Images

RPL36AL Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RPL36AL Rabbit Polyclonal Antibody

The RPL36AL Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to RPL36AL. This antibody recognizes Human antigen. The RPL36AL Rabbit Polyclonal Antibody has been validated for the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-RPL36AL Antibody

Product Specs
ItemRPL36AL Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA334365
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetRPL36AL
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-RPL36AL antibody is: synthetic peptide directed towards the C-terminal region of Human RPL36AL. Synthetic peptide located within the following region: RKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF
NCBI Full Gene Nameribosomal protein L36a like
NCBI Gene AliasesRPL36A
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!